- METTL11B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88494
- PBS (pH 7.2) and 40% Glycerol
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: GIIILKDNVA REGCILDLSD SSVTRDMDIL RSLIRKSGLV VLGQEKQDGF PEQCIPVWMF AL
- 0.1 ml (also 25ul)
- METTL11B
- Rabbit
- C1orf184, HOMT1B, METTL11B, NTM1B
- Human
- Unconjugated
- N-terminal Xaa-Pro-Lys N-methyltransferase 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL
Specifications/Features
Available conjugates: Unconjugated